PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN31220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 302aa    MW: 33781.7 Da    PI: 8.466
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN31220.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.9e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l++++k++G g+W++ ++  g+ R++k+c++rw +yl
       KHN31220.1 14 KGAWTKEEDERLINYIKLHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding60.43.8e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia++++ gRt++++k++w+++
       KHN31220.1  67 RGNFTEEEDELIINLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.02961IPR017930Myb domain
SMARTSM007172.8E-141363IPR001005SANT/Myb domain
SuperFamilySSF466896.7E-3013108IPR009057Homeodomain-like
PfamPF002495.1E-161461IPR001005SANT/Myb domain
CDDcd001672.63E-111661No hitNo description
PROSITE profilePS5129429.40162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2865116IPR009057Homeodomain-like
SMARTSM007172.3E-1866114IPR001005SANT/Myb domain
PfamPF002491.7E-1767111IPR001005SANT/Myb domain
CDDcd001673.29E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGRSPCCEKE HTNKGAWTKE EDERLINYIK LHGEGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIN LHSLLGNKWS LIAARLPGRT DNEIKNYWNT HIKRKLYSRG  120
IDPQTHRPLN ASATPATTAT ATAVPSANSS KKINNNNNNI DNDINNNNNG FQLVSNSAYA  180
NTKIGTNLVA AEDSNSSSGV TTEESVPHHQ LNLDLSIGLP SQPQGSSLNP EKLKPEPQEH  240
DDQKPQVLYK WYGNITSQQG VCLCYNLGLQ SNQTCYCKTM GTATTTTATD SNLYRFYRPM  300
NI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0971270.0BT097127.1 Soybean clone JCVI-FLGm-21J21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242477.10.0uncharacterized protein LOC100808083
SwissprotP813934e-90MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0B2RCW20.0A0A0B2RCW2_GLYSO; Myb-related protein 308
TrEMBLI1JXV20.0I1JXV2_SOYBN; Uncharacterized protein
STRINGGLYMA04G38240.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.12e-86myb domain protein 4
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]